Peptide Research Blog

 

 

Peptide News, Guides, and Research Insights

m2VO76HSvr2

Peptide Purity 101: A Beginner’s Guide to Mastering Lab Analysis

The chemical integrity of synthetic peptides serves as the foundation for all reproducible laboratory research....
TZgq8IpL35Q

Why MOTS-c Will Change the Way You Study Mitochondrial Signaling

Technical Specifications Product Name: MOTS-c Full Chemical Name: Mitochondrial Open Reading Frame of the 12S...
7YjXtgj9Pdw

RTA-3: The Next Frontier in Metabolic Research and Triple Agonist Dynamics

Technical Specifications Molecular Formula: C₂₂₁H₃₄₂N₅₂O₇₁ Molecular Weight: 4731.33 g/mol Sequence: Y-[Aib]-EGTFTSDYSILDKIQAKEFVQWLIAGGPSSGAPPPS (with specific fatty acid...
RxpTtwow5EQ

7 Mistakes You’re Making with Peptide Impurity Analysis (and How to Fix Them)

The characterization of synthetic peptides is a critical phase in biochemical research, where the identification...
gn-922AWMgH

Why MOTS-c Will Change the Way You Approach Mitochondrial Peptide Research

Technical Specifications Molecular Formula: C101H152N28O22S2 Molecular Weight: 2174.6 g/mol Sequence: MRWQEMGYIFYPRKLR (Met-Arg-Trp-Gln-Glu-Met-Gly-Tyr-Ile-Phe-Tyr-Pro-Arg-Lys-Leu-Arg) Purity: >98% (Assessed...
tG6Gi2ywacf

Peptide Analytics 101: A Beginner’s Guide to Mastering Purity Standards

Technical Overview of Peptide Standards Molecular Characterization: Identification via Mass Spectrometry (MS)Primary Analysis: High-Performance Liquid...
wz9anZZoGrN

7 Mistakes You’re Making with GHK-Cu in Your Laboratory (and How to Fix Them)

GHK-Cu (Glycyl-L-histidyl-L-lysine copper) is a naturally occurring tripeptide-copper complex first isolated from human plasma. In...
KOTah6hklkK

Peptide Purity vs Potency: Which Matters More for Your Lab Analysis (and When)?

In the rigorous landscape of biotechnology and pharmaceutical research, the distinction between peptide purity and...
oz44ZcchC-p

BPC-157 Matters: What Researchers Know About Cytoprotection, Angiogenesis Signaling, and Why Purity Makes or Breaks Your Data

Molecular Profile of BPC-157 BPC-157 (Body Protection Compound-157) is a synthetic pentadecapeptide derived from a...
gg0ZVpd4GqU

7 Mistakes You’re Making with BPC 157 and TB-500 Research (and How to Fix Them)

Compound identifiers (for experimental documentation) BPC 157 (Body Protection Compound 157) Class: Synthetic peptide fragment...