Sub-Total: $0.00
Peptide Research Blog
Peptide News, Guides, and Research Insights
Peptide Purity 101: A Beginner’s Guide to Mastering Lab Analysis
The chemical integrity of synthetic peptides serves as the foundation for all reproducible laboratory research....
Why MOTS-c Will Change the Way You Study Mitochondrial Signaling
Technical Specifications Product Name: MOTS-c Full Chemical Name: Mitochondrial Open Reading Frame of the 12S...
RTA-3: The Next Frontier in Metabolic Research and Triple Agonist Dynamics
Technical Specifications Molecular Formula: C₂₂₁H₃₄₂N₅₂O₇₁ Molecular Weight: 4731.33 g/mol Sequence: Y-[Aib]-EGTFTSDYSILDKIQAKEFVQWLIAGGPSSGAPPPS (with specific fatty acid...
7 Mistakes You’re Making with Peptide Impurity Analysis (and How to Fix Them)
The characterization of synthetic peptides is a critical phase in biochemical research, where the identification...
Why MOTS-c Will Change the Way You Approach Mitochondrial Peptide Research
Technical Specifications Molecular Formula: C101H152N28O22S2 Molecular Weight: 2174.6 g/mol Sequence: MRWQEMGYIFYPRKLR (Met-Arg-Trp-Gln-Glu-Met-Gly-Tyr-Ile-Phe-Tyr-Pro-Arg-Lys-Leu-Arg) Purity: >98% (Assessed...
Peptide Analytics 101: A Beginner’s Guide to Mastering Purity Standards
Technical Overview of Peptide Standards Molecular Characterization: Identification via Mass Spectrometry (MS)Primary Analysis: High-Performance Liquid...
7 Mistakes You’re Making with GHK-Cu in Your Laboratory (and How to Fix Them)
GHK-Cu (Glycyl-L-histidyl-L-lysine copper) is a naturally occurring tripeptide-copper complex first isolated from human plasma. In...
Peptide Purity vs Potency: Which Matters More for Your Lab Analysis (and When)?
In the rigorous landscape of biotechnology and pharmaceutical research, the distinction between peptide purity and...
- « Previous
- 1
- 2
- 3
- 4
- Next »