LL37

Description

LL-37 Peptide – Research Use Only

Description:

LL-37 is a naturally occurring antimicrobial peptide derived from the human cathelicidin antimicrobial peptide (CAMP) gene. It plays a critical role in the body’s innate immune system, exhibiting broad-spectrum antimicrobial, antiviral, and antifungal properties. LL-37 has been widely studied for its potential roles in wound healing, tissue regeneration, inflammation modulation, and immune regulation.

In laboratory and research environments, LL-37 is explored for its ability to promote angiogenesis, accelerate epithelial repair, and modulate inflammatory pathways. It has also drawn scientific interest for its potential in studies related to chronic infections, autoimmune conditions, and skin regeneration models.

---

Key Research Areas:

• Antimicrobial and antiviral studies
• Wound healing and tissue regeneration
• Immune modulation and inflammatory response
• Cell proliferation and angiogenesis research
• Dermatological and regenerative peptide research

---

Specifications:

• Peptide Name: LL-37
• Sequence: [LL-37, 37 aa]
• Form: Lyophilized powder
• Purity: ≥99% (HPLC)
• Storage: Store at -20°C; reconstituted solutions should be stored at -80°C and used promptly

---

Disclaimer:

All products, including LL-37, are intended for laboratory research use only.

• Not for human consumption.
• Not for medical, veterinary, or household use.
• Must be handled only by qualified professionals in controlled laboratory settings.
• The information provided is for educational and research purposes only.
• No therapeutic or diagnostic claims are made for this material.

For Research Use Only – Not for Human Consumption.